Lineage for d5kyje1 (5kyj E:218-458)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2335122Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2335123Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2335124Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2336144Protein automated matches [190059] (14 species)
    not a true protein
  7. 2336166Species Human (Homo sapiens) [TaxId:9606] [187214] (157 PDB entries)
  8. 2336417Domain d5kyje1: 5kyj E:218-458 [344336]
    Other proteins in same PDB: d5kyja2, d5kyjb2, d5kyje2, d5kyjf2
    automated match to d5i4va_
    complexed with 6y8

Details for d5kyje1

PDB Entry: 5kyj (more details), 2.8 Å

PDB Description: brain penetrant liver x receptor (lxr) modulators based on a 2,4,5,6- tetrahydropyrrolo[3,4-c]pyrazole core
PDB Compounds: (E:) oxysterols receptor lxr-beta

SCOPe Domain Sequences for d5kyje1:

Sequence, based on SEQRES records: (download)

>d5kyje1 a.123.1.1 (E:218-458) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqltaaqelmiqqlvaaqlqcnkrsfsdqpkvtpwplgadpasgsasqqrfahftelaii
svqeivdfakqvpgflqlgredqiallkastieimlletarrynhetecitflkdftysk
ddfhraglqvefinpifefsramrrlglddaeyalliainifsadrpnvqepgrvealqq
pyveallsytrikrpqdqlrfprmlmklvslrtlssvhseqvfalrlqdkklppllseiw
d

Sequence, based on observed residues (ATOM records): (download)

>d5kyje1 a.123.1.1 (E:218-458) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqltaaqelmiqqlvaaqlqcnkrsfsdqpkvtpwplgsasqqrfahftelaiisvqeiv
dfakqvpgflqlgredqiallkastieimlletarrynhetecitflkdftyskddfhra
glqvefinpifefsramrrlglddaeyalliainifsadrpnvqepgrvealqqpyveal
lsytrikrpqdqlrfprmlmklvslrtlssvhseqvfalrlqdkklppllseiwd

SCOPe Domain Coordinates for d5kyje1:

Click to download the PDB-style file with coordinates for d5kyje1.
(The format of our PDB-style files is described here.)

Timeline for d5kyje1:

  • d5kyje1 is new in SCOPe 2.07-stable