SCOPe 2.08: Domain d5kyja1: 5kyj A:218-459

Lineage for d5kyja1 (5kyj A:218-459)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)

6. Protein Oxysterols receptor LXR-beta [89149] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89150] (21 PDB entries)
   Uniprot P55055 219-461

8. Domain d5kyja1: 5kyj A:218-459 [344334]
   Other proteins in same PDB: d5kyja2, d5kyjb1, d5kyjb2, d5kyje2, d5kyjf1, d5kyjf2
   automated match to d5i4va_
   complexed with 6y8

Details for d5kyja1

PDB Entry: 5kyj, 2.8 Å

PDB Description: brain penetrant liver x receptor (lxr) modulators based on a 2,4,5,6- tetrahydropyrrolo[3,4-c]pyrazole core

PDB Compounds: (A:) oxysterols receptor lxr-beta

SCOPe Domain Sequences for d5kyja1:

Sequence; same for both SEQRES and ATOM records:

>d5kyja1 a.123.1.1 (A:218-459) Oxysterols receptor LXR-beta {Human (Homo sapiens) [TaxId: 9606]}
vqltaaqelmiqqlvaaqlqcnkrsfsdqpkvtpwplgadpasgsasqqrfahftelaii
svqeivdfakqvpgflqlgredqiallkastieimlletarrynhetecitflkdftysk
ddfhraglqvefinpifefsramrrlglddaeyalliainifsadrpnvqepgrvealqq
pyveallsytrikrpqdqlrfprmlmklvslrtlssvhseqvfalrlqdkklppllseiw
dv

Timeline for d5kyja1:

• d5kyja1 first appeared in SCOPe 2.07