SCOPe 2.08: Domain d5k8al2: 5k8a L:106-213

Lineage for d5k8al2 (5k8a L:106-213)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d5k8al2: 5k8a L:106-213 [344324]
   Other proteins in same PDB: d5k8aa1, d5k8ab_, d5k8ae1, d5k8af_, d5k8ah_, d5k8al1, d5k8am1, d5k8av_
   automated match to d1dn0a2

Details for d5k8al2

PDB Entry: 5k8a, 2 Å

PDB Description: nist fab

PDB Compounds: (L:) humanized Fab Lite chain

SCOPe Domain Sequences for d5k8al2:

Sequence; same for both SEQRES and ATOM records:

>d5k8al2 b.1.1.2 (L:106-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

Timeline for d5k8al2:

• d5k8al2 first appeared in SCOPe 2.07