SCOPe 2.08: Domain d5k3ih2: 5k3i H:290-483

Lineage for d5k3ih2 (5k3i H:290-483)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families)
   multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel

5. Family a.29.3.0: automated matches [227204] (1 protein)
   not a true family

6. Protein automated matches [226935] (30 species)
   not a true protein

7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [321815] (4 PDB entries)

8. Domain d5k3ih2: 5k3i H:290-483 [344321]
   Other proteins in same PDB: d5k3ia1, d5k3ib1, d5k3ic1, d5k3id1, d5k3ie1, d5k3if1, d5k3ig1, d5k3ih1
   automated match to d5k3ic2
   complexed with atp, fad, mg

Details for d5k3ih2

PDB Entry: 5k3i, 2.68 Å

PDB Description: crystal structure of acyl-coa oxidase-1 in caenorhabditis elegans complexed with fad and atp

PDB Compounds: (H:) Acyl-coenzyme A oxidase

SCOPe Domain Sequences for d5k3ih2:

Sequence; same for both SEQRES and ATOM records:

>d5k3ih2 a.29.3.0 (H:290-483) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
amvhvrsymltgqaimlsyalniatrysavrrqgqidknepevkvleyqtqqhrlfpfia
rayafqfagaetvklyervlkemksgnvslmadlhaltsglksvvthqtgegieqarmac
gghgysmasyiseiygvaiggctyagenmvmllqlarylvksaalvksgkasqlgplvay
lgarseptslidrv

Timeline for d5k3ih2:

• d5k3ih2 first appeared in SCOPe 2.07