Lineage for d5k3ih1 (5k3i H:2-282)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2570412Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 2570413Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 2570558Family e.6.1.0: automated matches [227203] (1 protein)
    not a true family
  6. 2570559Protein automated matches [226934] (28 species)
    not a true protein
  7. 2570684Species Nematode (Caenorhabditis elegans) [TaxId:6239] [321813] (4 PDB entries)
  8. 2570700Domain d5k3ih1: 5k3i H:2-282 [344320]
    Other proteins in same PDB: d5k3ia2, d5k3ia3, d5k3ib2, d5k3ib3, d5k3ic2, d5k3ic3, d5k3id2, d5k3id3, d5k3ie2, d5k3ie3, d5k3if2, d5k3if3, d5k3ig2, d5k3ig3, d5k3ih2, d5k3ih3
    automated match to d5k3ic1
    complexed with atp, fad, mg

Details for d5k3ih1

PDB Entry: 5k3i (more details), 2.68 Å

PDB Description: crystal structure of acyl-coa oxidase-1 in caenorhabditis elegans complexed with fad and atp
PDB Compounds: (H:) Acyl-coenzyme A oxidase

SCOPe Domain Sequences for d5k3ih1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k3ih1 e.6.1.0 (H:2-282) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
vhlnktiqegdnpdltaerltatfdthamaaqiyggemrarrrreitaklaeipelhdsm
plpymtreekimesarkltvltqrmseiidptdagelyhlnnevlgiegnpmalhgvmfi
palnaqasdeqqakwliralrreiigtyaqtemghgtnlqnlettatydigtqefvlhtp
kitalkwwpgnlgkssnyavvvahmyikgknfgphtfmvplrdekthkplpgitigdigp
kmaynivdngflgfnnyriprtnllmrhtkveadgtyikpp

SCOPe Domain Coordinates for d5k3ih1:

Click to download the PDB-style file with coordinates for d5k3ih1.
(The format of our PDB-style files is described here.)

Timeline for d5k3ih1:

  • d5k3ih1 is new in SCOPe 2.07-stable