![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
![]() | Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) ![]() |
![]() | Family d.142.1.0: automated matches [227184] (1 protein) not a true family |
![]() | Protein automated matches [226904] (38 species) not a true protein |
![]() | Species Flaveria trinervia [TaxId:4227] [332552] (3 PDB entries) |
![]() | Domain d5jvlb2: 5jvl B:258-380 [344296] Other proteins in same PDB: d5jvla2, d5jvla3, d5jvlb1, d5jvlb3, d5jvlc2, d5jvlc3, d5jvld2, d5jvld3 complexed with 6nq, mg, pep |
PDB Entry: 5jvl (more details), 2.9 Å
SCOPe Domain Sequences for d5jvlb2:
Sequence, based on SEQRES records: (download)
>d5jvlb2 d.142.1.0 (B:258-380) automated matches {Flaveria trinervia [TaxId: 4227]} ftrnpstgekklygeflinaqgedvvagirtpedlgtmetcmpeaykelvenceilerhy kdmmdieftvqenrlwmlqcrtgkrtgkgavriavdmvneglidtrtaikrvetqhldql lhp
>d5jvlb2 d.142.1.0 (B:258-380) automated matches {Flaveria trinervia [TaxId: 4227]} ftrnpstgekklylvenceilerhykdmmdirtgkrtgkgavriavdmvneglidtrtai krvetqhldqllhp
Timeline for d5jvlb2: