Lineage for d5jvlb2 (5jvl B:258-380)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2541368Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2541369Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2541793Family d.142.1.0: automated matches [227184] (1 protein)
    not a true family
  6. 2541794Protein automated matches [226904] (37 species)
    not a true protein
  7. 2541849Species Flaveria trinervia [TaxId:4227] [332552] (3 PDB entries)
  8. 2541853Domain d5jvlb2: 5jvl B:258-380 [344296]
    Other proteins in same PDB: d5jvla2, d5jvla3, d5jvlb1, d5jvlb3, d5jvlc2, d5jvlc3, d5jvld2, d5jvld3
    complexed with 6nq, mg, pep

Details for d5jvlb2

PDB Entry: 5jvl (more details), 2.9 Å

PDB Description: c4-type pyruvate phospate dikinase: nucleotide binding domain with bound atp analogue
PDB Compounds: (B:) Pyruvate, phosphate dikinase, chloroplastic

SCOPe Domain Sequences for d5jvlb2:

Sequence, based on SEQRES records: (download)

>d5jvlb2 d.142.1.0 (B:258-380) automated matches {Flaveria trinervia [TaxId: 4227]}
ftrnpstgekklygeflinaqgedvvagirtpedlgtmetcmpeaykelvenceilerhy
kdmmdieftvqenrlwmlqcrtgkrtgkgavriavdmvneglidtrtaikrvetqhldql
lhp

Sequence, based on observed residues (ATOM records): (download)

>d5jvlb2 d.142.1.0 (B:258-380) automated matches {Flaveria trinervia [TaxId: 4227]}
ftrnpstgekklylvenceilerhykdmmdirtgkrtgkgavriavdmvneglidtrtai
krvetqhldqllhp

SCOPe Domain Coordinates for d5jvlb2:

Click to download the PDB-style file with coordinates for d5jvlb2.
(The format of our PDB-style files is described here.)

Timeline for d5jvlb2:

  • d5jvlb2 is new in SCOPe 2.07-stable