Lineage for d1eg5a_ (1eg5 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2131439Family c.67.1.3: Cystathionine synthase-like [53402] (17 protein domains)
  6. 2131608Protein NifS-like protein/selenocysteine lyase [53412] (3 species)
  7. 2131615Species Thermotoga maritima [TaxId:2336] [53413] (2 PDB entries)
  8. 2131616Domain d1eg5a_: 1eg5 A: [34429]
    complexed with plp, so4

Details for d1eg5a_

PDB Entry: 1eg5 (more details), 2 Å

PDB Description: nifs-like protein
PDB Compounds: (A:) aminotransferase

SCOPe Domain Sequences for d1eg5a_:

Sequence, based on SEQRES records: (download)

>d1eg5a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Thermotoga maritima [TaxId: 2336]}
mrvyfdnnattrvddrvleemivfyrekygnpnsahgmgieanlhmekarekvakvlgvs
pseifftscatesinwilktvaetfekrkrtiittpiehkavletmkylsmkgfkvkyvp
vdsrgvvkleeleklvdedtflvsimaannevgtiqpvedvtrivkkknketlvhvdavq
tigkipfsleklevdyasfsahkfhgpkgvgityirkgvpirplihgggqerglrsgtqn
vpgivgaarameiaveelseaakhmeklrsklvsglmnlgahiitpleislpntlsvsfp
nirgstlqnllsgygiyvstssactskderlrhvldamgvdrriaqgairislckyntee
evdyflkkieeilsfl

Sequence, based on observed residues (ATOM records): (download)

>d1eg5a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Thermotoga maritima [TaxId: 2336]}
mrvyfdnnattrvddrvleemivfyrekygnpnsahgmgieanlhmekarekvakvlgvs
pseifftscatesinwilktvaetfekrkrtiittpiehkavletmkylsmkgfkvkyvp
vdsrgvvkleeleklvdedtflvsimaannevgtiqpvedvtrivkkknketlvhvdavq
tigkipfsleklevdyasfsahkfhgpkgvgityirkgvpirplihgggqerglrsgtqn
vpgivgaarameiaveelseaakhmeklrsklvsglmnlgahiitpleislpntlsvsfp
nirgstlqnllsgygiyvsthvldamgvdrriaqgairislckynteeevdyflkkieei
lsfl

SCOPe Domain Coordinates for d1eg5a_:

Click to download the PDB-style file with coordinates for d1eg5a_.
(The format of our PDB-style files is described here.)

Timeline for d1eg5a_: