Lineage for d5jhaa4 (5jha A:357-522)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2368400Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2368401Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) (S)
    two constituent families are related by circular permutation
  5. 2368402Family b.7.1.1: PLC-like (P variant) [49563] (12 proteins)
  6. 2368425Protein Phoshoinositide 3-kinase (PI3K) [49570] (2 species)
  7. 2368426Species Human (Homo sapiens) [TaxId:9606] [49572] (67 PDB entries)
  8. 2368464Domain d5jhaa4: 5jha A:357-522 [344288]
    Other proteins in same PDB: d5jhaa1, d5jhaa2, d5jhaa3
    complexed with 6k7, so4

Details for d5jhaa4

PDB Entry: 5jha (more details), 2.51 Å

PDB Description: structure of phosphoinositide 3-kinase gamma (pi3k) bound to the potent inhibitor pikin2
PDB Compounds: (A:) Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d5jhaa4:

Sequence, based on SEQRES records: (download)

>d5jhaa4 b.7.1.1 (A:357-522) Phoshoinositide 3-kinase (PI3K) {Human (Homo sapiens) [TaxId: 9606]}
cdrkfrvkirgidipvlprntdltvfveaniqhgqqvlcqrrtspkpfteevlwnvwlef
sikikdlpkgallnlqiycgkapalsskasaespsseskgkvqllyyvnlllidhrfllr
rgeyvlhmwqisgkgedqgsfnadkltsatnpdkensmsisilldn

Sequence, based on observed residues (ATOM records): (download)

>d5jhaa4 b.7.1.1 (A:357-522) Phoshoinositide 3-kinase (PI3K) {Human (Homo sapiens) [TaxId: 9606]}
cdrkfrvkirgidipvlltvfveaniqhgqqvlcqrrtspkpfteevlwnvwlefsikik
dlpkgallnlqiycllyyvnlllidhrfllrrgeyvlhmwqisgfnadkltsatnpdken
smsisilldn

SCOPe Domain Coordinates for d5jhaa4:

Click to download the PDB-style file with coordinates for d5jhaa4.
(The format of our PDB-style files is described here.)

Timeline for d5jhaa4: