Lineage for d5imsb3 (5ims B:461-647)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2445862Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2445863Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2446153Family c.36.1.9: Pyruvate oxidase and decarboxylase PP module [88749] (8 proteins)
    the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology
  6. 2446154Protein Acetohydroxyacid synthase catalytic subunit [88758] (3 species)
  7. 2446174Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [314110] (3 PDB entries)
  8. 2446176Domain d5imsb3: 5ims B:461-647 [344277]
    Other proteins in same PDB: d5imsa1, d5imsa2, d5imsb1, d5imsb2
    complexed with act, fad, k, mg, oxy, po4, tpp

Details for d5imsb3

PDB Entry: 5ims (more details), 1.98 Å

PDB Description: saccharomyces cerevisiae acetohydroxyacid synthase
PDB Compounds: (B:) Acetolactate synthase catalytic subunit, mitochondrial

SCOPe Domain Sequences for d5imsb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5imsb3 c.36.1.9 (B:461-647) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
aymeetpgskikpqtvikklskvandtgrhvivttgvgqhqmwaaqhwtwrnphtfitsg
glgtmgyglpaaigaqvakpeslvididgdasfnmtltelssavqagtpvkililnneeq
gmvtqwqslfyehryshthqlnpdfiklaeamglkglrvkkqeeldaklkefvstkgpvl
levevdk

SCOPe Domain Coordinates for d5imsb3:

Click to download the PDB-style file with coordinates for d5imsb3.
(The format of our PDB-style files is described here.)

Timeline for d5imsb3:

  • d5imsb3 is new in SCOPe 2.07-stable