SCOPe 2.08: Domain d5imsa3: 5ims A:461-647

Lineage for d5imsa3 (5ims A:461-647)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.9: Pyruvate oxidase and decarboxylase PP module [88749] (8 proteins)
   the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology

6. Protein Acetohydroxyacid synthase catalytic subunit [88758] (3 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [314110] (3 PDB entries)

8. Domain d5imsa3: 5ims A:461-647 [344276]
   Other proteins in same PDB: d5imsa1, d5imsa2, d5imsb1, d5imsb2
   complexed with act, fad, k, mg, oxy, po4, tpp

Details for d5imsa3

PDB Entry: 5ims, 1.98 Å

PDB Description: saccharomyces cerevisiae acetohydroxyacid synthase

PDB Compounds: (A:) Acetolactate synthase catalytic subunit, mitochondrial

SCOPe Domain Sequences for d5imsa3:

Sequence, based on SEQRES records:

>d5imsa3 c.36.1.9 (A:461-647) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
aymeetpgskikpqtvikklskvandtgrhvivttgvgqhqmwaaqhwtwrnphtfitsg
glgtmgyglpaaigaqvakpeslvididgdasfnmtltelssavqagtpvkililnneeq
gmvtqwqslfyehryshthqlnpdfiklaeamglkglrvkkqeeldaklkefvstkgpvl
levevdk

Sequence, based on observed residues (ATOM records):

>d5imsa3 c.36.1.9 (A:461-647) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
aymeetpgskikpqtvikklskvandtgrhvivttgvgqhqmwaaqhwtwrnphtfitsg
glgtmgyglpaaigaqvakpeslvididgdasfnmtltelssavqagtpvkililnneeh
thqlnpdfiklaeamglkglrvkkqeeldaklkefvstkgpvllevevdk

Timeline for d5imsa3:

• d5imsa3 first appeared in SCOPe 2.07