Lineage for d5hekb_ (5hek B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2894468Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2894469Protein automated matches [190689] (87 species)
    not a true protein
  7. 2894658Species Helicobacter pylori [TaxId:85962] [225261] (5 PDB entries)
  8. 2894669Domain d5hekb_: 5hek B: [344264]
    automated match to d5heka_

Details for d5hekb_

PDB Entry: 5hek (more details), 3 Å

PDB Description: crystal structure of m1.hpyavi
PDB Compounds: (B:) Adenine specific DNA methyltransferase (DpnA)

SCOPe Domain Sequences for d5hekb_:

Sequence, based on SEQRES records: (download)

>d5hekb_ c.66.1.0 (B:) automated matches {Helicobacter pylori [TaxId: 85962]}
miqiyhadafeiikdfyqqnlkvdaiitdppynisvknnfptlksakrqgidfgewdknf
kllewiaryaplvnpngcmvifcsyrfisyiadfleengfvvkdfiqwvknnpmprnihr
ryvqdtefalwavkkkakwvfnkpknekylrplilkspvvsglektkhptqkslalmeki
isihtnpndivldpfmgsgttglacknlernfigiesekeyfqtakkrlnl

Sequence, based on observed residues (ATOM records): (download)

>d5hekb_ c.66.1.0 (B:) automated matches {Helicobacter pylori [TaxId: 85962]}
miqiyhadafeiikdfyqqnlkvdaiitdppnfkllewiaryaplvnpngcmvifcsyrf
isyiadfleengfvvkdfiqwvknnpmpnihrryvqdtefalwavkkkakwvfnkpknek
ylrpllslalmekiisihtnpndivldpfmgsgttglacknlernfigiesekeyfqtak
krlnl

SCOPe Domain Coordinates for d5hekb_:

Click to download the PDB-style file with coordinates for d5hekb_.
(The format of our PDB-style files is described here.)

Timeline for d5hekb_: