SCOPe 2.08: Domain d5gthx_: 5gth X:

Lineage for d5gthx_ (5gth X:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.40: Photosystem II reaction center protein X, PsbX [267599] (1 family)
   Pfam PF06596

5. Family f.23.40.1: PsbX-like [267615] (2 proteins)

6. Protein automated matches [267680] (2 species)
   not a true protein

7. Species Thermosynechococcus vulcanus [TaxId:32053] [267915] (27 PDB entries)

8. Domain d5gthx_: 5gth X: [344262]
   Other proteins in same PDB: d5gtha_, d5gthb_, d5gthc_, d5gthd_, d5gthe_, d5gthf_, d5gthh_, d5gthi_, d5gthj_, d5gthk_, d5gthl_, d5gthm1, d5gthm2, d5gtho_, d5gtht_, d5gthu_, d5gthv_, d5gthz_
   automated match to d4il6x_
   complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d5gthx_

PDB Entry: 5gth, 2.5 Å

PDB Description: native xfel structure of photosystem ii (dark dataset)

PDB Compounds: (X:) Photosystem II reaction center protein X

SCOPe Domain Sequences for d5gthx_:

Sequence; same for both SEQRES and ATOM records:

>d5gthx_ f.23.40.1 (X:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
titpslkgffigllsgavvlgltfavliaisqidkvqr

Timeline for d5gthx_:

• d5gthx_ first appeared in SCOPe 2.07