Lineage for d1c7od_ (1c7o D:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 26196Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
  4. 26197Superfamily c.67.1: PLP-dependent transferases [53383] (5 families) (S)
  5. 26361Family c.67.1.3: Cystathionine synthase-like [53402] (6 proteins)
  6. 26362Protein Cystalysin [53410] (1 species)
  7. 26363Species Treponema denticola [TaxId:158] [53411] (2 PDB entries)
  8. 26375Domain d1c7od_: 1c7o D: [34424]

Details for d1c7od_

PDB Entry: 1c7o (more details), 2.5 Å

PDB Description: crystal structure of cystalysin from treponema denticola contains a pyridoxal 5'-phosphate-l-aminoethoxyvinylglycine complex

SCOP Domain Sequences for d1c7od_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c7od_ c.67.1.3 (D:) Cystalysin {Treponema denticola}
miydfttkisrknlgslkwdlmysqnpevgnevvplsvadmefknppelieglkkyldet
vlgytgpteeykktvkkwmkdrhqwdiqtdwiintagvvpavfnavreftkpgdgviiit
pvyypffmaiknqerkiiecellekdgyytidfqkleklskdknnkallfcsphnpvgrv
wkkdelqkikdivlksdlmlwsdeihfdlimpgyehtvfqsideqladktitftapsktf
niagmgmsniiiknpdirerftksrdatsgmpfttlgykaceicykecgkwldgcikvid
knqrivkdffevnhpeikapliegtylqwidfralkmdhkameefmihkaqiffdegyif
gdggigferinlaapssviqeslerlnkalkdlk

SCOP Domain Coordinates for d1c7od_:

Click to download the PDB-style file with coordinates for d1c7od_.
(The format of our PDB-style files is described here.)

Timeline for d1c7od_: