Lineage for d5gs1e2 (5gs1 E:124-229)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2755921Domain d5gs1e2: 5gs1 E:124-229 [344235]
    Other proteins in same PDB: d5gs1b_, d5gs1g2, d5gs1h2, d5gs1n_, d5gs1p_, d5gs1r_
    automated match to d5dr5l1

Details for d5gs1e2

PDB Entry: 5gs1 (more details), 2 Å

PDB Description: crystal structure of homo-specific diabody
PDB Compounds: (E:) diabody

SCOPe Domain Sequences for d5gs1e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gs1e2 b.1.1.0 (E:124-229) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divltqspatlslspgeratlscrasqsvssnylawyqqkpgqaprlliydsssratgvp
arfsgsgsgtdftltisslepedfavyychqysdisptfgqgtkve

SCOPe Domain Coordinates for d5gs1e2:

Click to download the PDB-style file with coordinates for d5gs1e2.
(The format of our PDB-style files is described here.)

Timeline for d5gs1e2: