![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (31 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
![]() | Domain d5gs1d1: 5gs1 D:1-123 [344232] Other proteins in same PDB: d5gs1b_, d5gs1g2, d5gs1h2, d5gs1n_, d5gs1p_, d5gs1r_ automated match to d5dr5l1 |
PDB Entry: 5gs1 (more details), 2 Å
SCOPe Domain Sequences for d5gs1d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5gs1d1 b.1.1.0 (D:1-123) automated matches {Human (Homo sapiens) [TaxId: 9606]} vqlvesggglvqpggslrlscaasgftfrnsamhwvrqapgkglewvssiwysgsntyya dsvkgrftisrdnskntlylqmnsltaedtavyycarfaggwgaydvwgqgtlvtvssgg ggs
Timeline for d5gs1d1:
![]() Domains from other chains: (mouse over for more information) d5gs1a_, d5gs1b_, d5gs1c1, d5gs1c2, d5gs1e1, d5gs1e2, d5gs1f1, d5gs1f2, d5gs1g1, d5gs1g2, d5gs1h1, d5gs1h2, d5gs1i1, d5gs1i2, d5gs1j1, d5gs1j2, d5gs1k1, d5gs1k2, d5gs1l1, d5gs1l2, d5gs1m_, d5gs1n_, d5gs1o_, d5gs1p_, d5gs1q_, d5gs1r_ |