Lineage for d5gs1c2 (5gs1 C:124-229)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2366842Domain d5gs1c2: 5gs1 C:124-229 [344231]
    Other proteins in same PDB: d5gs1b_, d5gs1g2, d5gs1h2, d5gs1n_, d5gs1p_, d5gs1r_
    automated match to d5dr5l1

Details for d5gs1c2

PDB Entry: 5gs1 (more details), 2 Å

PDB Description: crystal structure of homo-specific diabody
PDB Compounds: (C:) diabody

SCOPe Domain Sequences for d5gs1c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gs1c2 b.1.1.0 (C:124-229) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divltqspatlslspgeratlscrasqsvssnylawyqqkpgqaprlliydsssratgvp
arfsgsgsgtdftltisslepedfavyychqysdisptfgqgtkve

SCOPe Domain Coordinates for d5gs1c2:

Click to download the PDB-style file with coordinates for d5gs1c2.
(The format of our PDB-style files is described here.)

Timeline for d5gs1c2:

2366842
d5gs1c2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d5gs1c1