Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (29 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries) |
Domain d5gs1c2: 5gs1 C:124-229 [344231] Other proteins in same PDB: d5gs1b_, d5gs1g2, d5gs1h2, d5gs1n_, d5gs1p_, d5gs1r_ automated match to d5dr5l1 |
PDB Entry: 5gs1 (more details), 2 Å
SCOPe Domain Sequences for d5gs1c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5gs1c2 b.1.1.0 (C:124-229) automated matches {Human (Homo sapiens) [TaxId: 9606]} divltqspatlslspgeratlscrasqsvssnylawyqqkpgqaprlliydsssratgvp arfsgsgsgtdftltisslepedfavyychqysdisptfgqgtkve
Timeline for d5gs1c2:
View in 3D Domains from other chains: (mouse over for more information) d5gs1a_, d5gs1b_, d5gs1d1, d5gs1d2, d5gs1e1, d5gs1e2, d5gs1f1, d5gs1f2, d5gs1g1, d5gs1g2, d5gs1h1, d5gs1h2, d5gs1i1, d5gs1i2, d5gs1j1, d5gs1j2, d5gs1k1, d5gs1k2, d5gs1l1, d5gs1l2, d5gs1m_, d5gs1n_, d5gs1o_, d5gs1p_, d5gs1q_, d5gs1r_ |