Lineage for d5efqb1 (5efq B:21-157)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2326510Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2326511Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2326512Family a.74.1.1: Cyclin [47955] (9 protein domains)
  6. 2326968Protein automated matches [227027] (3 species)
    not a true protein
  7. 2326982Species Human (Homo sapiens) [TaxId:9606] [225840] (13 PDB entries)
  8. 2326999Domain d5efqb1: 5efq B:21-157 [344210]
    Other proteins in same PDB: d5efqa_, d5efqc_
    automated match to d2i53a1
    complexed with adp, af3, mg

Details for d5efqb1

PDB Entry: 5efq (more details), 2 Å

PDB Description: crystal structure of human cdk13/cyclin k in complex with adp-aluminum fluoride
PDB Compounds: (B:) cyclin-k

SCOPe Domain Sequences for d5efqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5efqb1 a.74.1.1 (B:21-157) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kpcwywdkkdlahtpsqlegldpatearyrregarfifdvgtrlglhydtlatgiiyfhr
fymfhsfkqfpryvtgacclflagkveetpkkckdiiktarsllndvqfgqfgddpkeev
mvlerillqtikfdlqv

SCOPe Domain Coordinates for d5efqb1:

Click to download the PDB-style file with coordinates for d5efqb1.
(The format of our PDB-style files is described here.)

Timeline for d5efqb1:

  • d5efqb1 is new in SCOPe 2.07-stable