Lineage for d1c7nh_ (1c7n H:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2895682Family c.67.1.3: Cystathionine synthase-like [53402] (17 proteins)
  6. 2895726Protein Cystalysin [53410] (1 species)
    PLP-dependent haemolytic enzyme
  7. 2895727Species Treponema denticola [TaxId:158] [53411] (2 PDB entries)
  8. 2895735Domain d1c7nh_: 1c7n H: [34420]
    complexed with plp

Details for d1c7nh_

PDB Entry: 1c7n (more details), 1.9 Å

PDB Description: crystal structure of cystalysin from treponema denticola contains a pyridoxal 5'-phosphate cofactor
PDB Compounds: (H:) cystalysin

SCOPe Domain Sequences for d1c7nh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c7nh_ c.67.1.3 (H:) Cystalysin {Treponema denticola [TaxId: 158]}
miydfttkisrknlgslkwdlmysqnpevgnevvplsvadmefknppelieglkkyldet
vlgytgpteeykktvkkwmkdrhqwdiqtdwiintagvvpavfnavreftkpgdgviiit
pvyypffmaiknqerkiiecellekdgyytidfqkleklskdknnkallfcsphnpvgrv
wkkdelqkikdivlksdlmlwsdeihfdlimpgyehtvfqsideqladktitftapsktf
niagmgmsniiiknpdirerftksrdatsgmpfttlgykaceicykecgkwldgcikvid
knqrivkdffevnhpeikapliegtylqwidfralkmdhkameefmihkaqiffdegyif
gdggigferinlaapssviqeslerlnkalkdlk

SCOPe Domain Coordinates for d1c7nh_:

Click to download the PDB-style file with coordinates for d1c7nh_.
(The format of our PDB-style files is described here.)

Timeline for d1c7nh_: