SCOPe 2.08: Domain d5dhxl1: 5dhx L:1-110

Lineage for d5dhxl1 (5dhx L:1-110)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225523] (30 PDB entries)

8. Domain d5dhxl1: 5dhx L:1-110 [344191]
   Other proteins in same PDB: d5dhxb2, d5dhxl3
   automated match to d3t0va_

Details for d5dhxl1

PDB Entry: 5dhx, 2.9 Å

PDB Description: hiv-1 rev ntd dimers with variable crossing angles

PDB Compounds: (L:) Anti-Rev Antibody Fab single-chain variable fragment, light chain,Anti-Rev Antibody Fab single-chain variable fragment, heavy chain

SCOPe Domain Sequences for d5dhxl1:

Sequence; same for both SEQRES and ATOM records:

>d5dhxl1 b.1.1.0 (L:1-110) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
elvmtqtpssvsepvggtvtikcqasqsisswlswyqqkpgqppklliydasnlasgvps
rfmgsgsgteytltisgvqredaatyyclggypaasyrtafgggteleii

Timeline for d5dhxl1:

• d5dhxl1 first appeared in SCOPe 2.07