Lineage for d1c7ng_ (1c7n G:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 589118Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 589119Superfamily c.67.1: PLP-dependent transferases [53383] (6 families) (S)
  5. 589415Family c.67.1.3: Cystathionine synthase-like [53402] (14 proteins)
  6. 589430Protein Cystalysin [53410] (1 species)
    PLP-dependent haemolytic enzyme
  7. 589431Species Treponema denticola [TaxId:158] [53411] (2 PDB entries)
  8. 589438Domain d1c7ng_: 1c7n G: [34419]

Details for d1c7ng_

PDB Entry: 1c7n (more details), 1.9 Å

PDB Description: crystal structure of cystalysin from treponema denticola contains a pyridoxal 5'-phosphate cofactor

SCOP Domain Sequences for d1c7ng_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c7ng_ c.67.1.3 (G:) Cystalysin {Treponema denticola}
miydfttkisrknlgslkwdlmysqnpevgnevvplsvadmefknppelieglkkyldet
vlgytgpteeykktvkkwmkdrhqwdiqtdwiintagvvpavfnavreftkpgdgviiit
pvyypffmaiknqerkiiecellekdgyytidfqkleklskdknnkallfcsphnpvgrv
wkkdelqkikdivlksdlmlwsdeihfdlimpgyehtvfqsideqladktitftapsktf
niagmgmsniiiknpdirerftksrdatsgmpfttlgykaceicykecgkwldgcikvid
knqrivkdffevnhpeikapliegtylqwidfralkmdhkameefmihkaqiffdegyif
gdggigferinlaapssviqeslerlnkalkdlk

SCOP Domain Coordinates for d1c7ng_:

Click to download the PDB-style file with coordinates for d1c7ng_.
(The format of our PDB-style files is described here.)

Timeline for d1c7ng_: