Lineage for d5daka2 (5dak A:0-76)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2484529Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 2484899Protein Class pi GST [81358] (4 species)
  7. 2484900Species Human (Homo sapiens) [TaxId:9606] [52864] (63 PDB entries)
  8. 2485025Domain d5daka2: 5dak A:0-76 [344184]
    Other proteins in same PDB: d5daka1, d5dakb1
    complexed with ars, mes

Details for d5daka2

PDB Entry: 5dak (more details), 2.11 Å

PDB Description: crystal structure of human glutathione transferase pi complexed with a metalloid in the absence of glutathione
PDB Compounds: (A:) Glutathione S-transferase P

SCOPe Domain Sequences for d5daka2:

Sequence, based on SEQRES records: (download)

>d5daka2 c.47.1.5 (A:0-76) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
mppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgd
ltlyqsntilrhlgrtl

Sequence, based on observed residues (ATOM records): (download)

>d5daka2 c.47.1.5 (A:0-76) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
mppytvvyfpvrgrcaalrmlladqgqswkeevvtqlpkfqdgdltlyqsntilrhlgrt
l

SCOPe Domain Coordinates for d5daka2:

Click to download the PDB-style file with coordinates for d5daka2.
(The format of our PDB-style files is described here.)

Timeline for d5daka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5daka1