![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
![]() | Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) ![]() |
![]() | Family d.142.1.10: Tubulin tyrosine ligase (TTL) C-terminal domain-like [310626] (2 proteins) Pfam PF03133; PubMed 22020298 |
![]() | Protein Tubulin tyrosine ligase (TTL) C-terminal domain [310728] (3 species) |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [311385] (176 PDB entries) |
![]() | Domain d5ca1f2: 5ca1 F:77-378 [344167] Other proteins in same PDB: d5ca1a1, d5ca1a2, d5ca1b1, d5ca1b2, d5ca1c1, d5ca1c2, d5ca1d1, d5ca1d2, d5ca1e_, d5ca1f1, d5ca1f3 automated match to d3tiia2 complexed with acp, ca, gdp, gol, gtp, mes, mg, nzo |
PDB Entry: 5ca1 (more details), 2.4 Å
SCOPe Domain Sequences for d5ca1f2:
Sequence, based on SEQRES records: (download)
>d5ca1f2 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} lvkliktspelsesctwfpesyviyptnlktpvapaqngirhlinntrtderevflaayn rrregregnvwiakssagakgegilisseaselldfideqgqvhviqkylekplllepgh rkfdirswvlvdhlyniylyregvlrtssepynsanfqdktchltnhciqkeysknygry eegnemffeefnqylmdalnttlensillqikhiirsclmciepaistkhlhyqsfqlfg fdfmvdeelkvwlievngapacaqklyaelcqgivdvaissvfpladtgqktsqptsifi kl
>d5ca1f2 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} lvkliktspelsesctwfpesyviyptderevflaaynrrregregnvwialisseasel ldfideqgqvhviqkylekplllepghrkfdirswvlvdhlyniylyregvlrtssepyn sanfqdktchltnhciqknygryeegnemffeefnqylmdalnttlensillqikhiirs clmciepaistkhlhyqsfqlfgfdfmvdeelkvwlievngapacaqklyaelcqgivdv aissvfplatsifikl
Timeline for d5ca1f2: