| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.4: PurM N-terminal domain-like [55326] (2 families) ![]() |
| Family d.79.4.1: PurM N-terminal domain-like [55327] (7 proteins) |
| Protein Aminoimidazole ribonucleotide synthetase (PurM) N-terminal domain [55328] (3 species) |
| Species Thermus thermophilus HB8 [TaxId:300852] [346369] (1 PDB entry) |
| Domain d5avmh2: 5avm H:51-166 [344152] Other proteins in same PDB: d5avma1, d5avmb1, d5avmc1, d5avmd1, d5avme1, d5avmf1, d5avmg1, d5avmh1 complexed with so4 |
PDB Entry: 5avm (more details), 2.2 Å
SCOPe Domain Sequences for d5avmh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5avmh2 d.79.4.1 (H:51-166) Aminoimidazole ribonucleotide synthetase (PurM) N-terminal domain {Thermus thermophilus HB8 [TaxId: 300852]}
leepvlvattdgvgtktllaleagdvsglgfdlvnhsvndllaqgaeplffldylaashl
degvlaallaslaeacrahgipllggetaempgvyregawdiagtlvgvversril
Timeline for d5avmh2: