Lineage for d5avme2 (5avm E:53-166)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2960238Superfamily d.79.4: PurM N-terminal domain-like [55326] (2 families) (S)
  5. 2960239Family d.79.4.1: PurM N-terminal domain-like [55327] (7 proteins)
  6. 2960240Protein Aminoimidazole ribonucleotide synthetase (PurM) N-terminal domain [55328] (3 species)
  7. 2960249Species Thermus thermophilus HB8 [TaxId:300852] [346369] (1 PDB entry)
  8. 2960254Domain d5avme2: 5avm E:53-166 [344149]
    Other proteins in same PDB: d5avma1, d5avmb1, d5avmc1, d5avmd1, d5avme1, d5avmf1, d5avmg1, d5avmh1
    complexed with so4

Details for d5avme2

PDB Entry: 5avm (more details), 2.2 Å

PDB Description: crystal structures of 5-aminoimidazole ribonucleotide (air) synthetase, purm, from thermus thermophilus
PDB Compounds: (E:) phosphoribosylformylglycinamidine cyclo-ligase

SCOPe Domain Sequences for d5avme2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5avme2 d.79.4.1 (E:53-166) Aminoimidazole ribonucleotide synthetase (PurM) N-terminal domain {Thermus thermophilus HB8 [TaxId: 300852]}
epvlvattdgvgtktllaleagdvsglgfdlvnhsvndllaqgaeplffldylaashlde
gvlaallaslaeacrahgipllggetaempgvyregawdiagtlvgvversril

SCOPe Domain Coordinates for d5avme2:

Click to download the PDB-style file with coordinates for d5avme2.
(The format of our PDB-style files is described here.)

Timeline for d5avme2: