| Class b: All beta proteins [48724] (178 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (29 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries) |
| Domain d4wwie2: 4wwi E:240-341 [344126] Other proteins in same PDB: d4wwia_, d4wwib_, d4wwic_ |
PDB Entry: 4wwi (more details), 2.31 Å
SCOPe Domain Sequences for d4wwie2:
Sequence, based on SEQRES records: (download)
>d4wwie2 b.1.1.0 (E:240-341) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vflfppkpkdtlmisrtpevtcvvvdvshedpevqfkwyvdgvevhnaktkpreeqfnst
frvvsvltvlhqdwlngkeykckvsnkalpapiektisktkg
>d4wwie2 b.1.1.0 (E:240-341) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vflfppkpkdtlmisrtpevtcvvvdfkwyvdgvevhnaktkprvvsvltvlhqdwlngk
eykckviektisktkg
Timeline for d4wwie2: