SCOPe 2.07: Domain d4wwie2: 4wwi E:240-341

Lineage for d4wwie2 (4wwi E:240-341)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d4wwie2: 4wwi E:240-341 [344126]
   Other proteins in same PDB: d4wwia_, d4wwib_, d4wwic_

Details for d4wwie2

PDB Entry: 4wwi, 2.31 Å

PDB Description: crystal structure of the c domain of staphylococcal protein a in complex with the fc fragment of human igg at 2.3 angstrom resolution

PDB Compounds: (E:) Ig gamma-3 chain C region

SCOPe Domain Sequences for d4wwie2:

Sequence, based on SEQRES records:

>d4wwie2 b.1.1.0 (E:240-341) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vflfppkpkdtlmisrtpevtcvvvdvshedpevqfkwyvdgvevhnaktkpreeqfnst
frvvsvltvlhqdwlngkeykckvsnkalpapiektisktkg

Sequence, based on observed residues (ATOM records):

>d4wwie2 b.1.1.0 (E:240-341) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vflfppkpkdtlmisrtpevtcvvvdfkwyvdgvevhnaktkprvvsvltvlhqdwlngk
eykckviektisktkg

Timeline for d4wwie2:

• d4wwie2 is new in SCOPe 2.07-stable
  
• d4wwie2 appears in the current release, SCOPe 2.08