Lineage for d4wa8b2 (4wa8 B:1-218)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2529111Fold c.120: PIN domain-like [88722] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145
  4. 2529112Superfamily c.120.1: PIN domain-like [88723] (3 families) (S)
  5. 2529220Family c.120.1.0: automated matches [227267] (1 protein)
    not a true family
  6. 2529221Protein automated matches [227060] (2 species)
    not a true protein
  7. 2529224Species Methanopyrus kandleri [TaxId:190192] [260992] (1 PDB entry)
  8. 2529226Domain d4wa8b2: 4wa8 B:1-218 [344125]
    Other proteins in same PDB: d4wa8a2, d4wa8b1
    complexed with cl

Details for d4wa8b2

PDB Entry: 4wa8 (more details), 2.2 Å

PDB Description: Methanopyrus Kandleri FEN-1 nuclease
PDB Compounds: (B:) flap endonuclease 1

SCOPe Domain Sequences for d4wa8b2:

Sequence, based on SEQRES records: (download)

>d4wa8b2 c.120.1.0 (B:1-218) automated matches {Methanopyrus kandleri [TaxId: 190192]}
mglaelreliepeetdlralagreiaidafnalyqflttimkdgrplmdsrgritshlng
llyrtvnlveegikpvyvfdgeppdlkretlerrrerkeeameklrraktkeerekyarq
varldeslvedakrlldlmgipwvqapsegeaqcaymarcgdvwatgsqdydsllfgspr
lvrnitivgkrkhphtgeiievkpeimrledvldqlgl

Sequence, based on observed residues (ATOM records): (download)

>d4wa8b2 c.120.1.0 (B:1-218) automated matches {Methanopyrus kandleri [TaxId: 190192]}
mglaelreliepeetdlralagreiaidafnalyqflttimkrplmdsrgritshlngll
yrtvnlveegikpvyvfdgeppldeslvedakrlldlmgipwvqapsegeaqcaymarcg
dvwatgsqdydsllfgsprlvrnitivgkriievkpeimrledvldqlgl

SCOPe Domain Coordinates for d4wa8b2:

Click to download the PDB-style file with coordinates for d4wa8b2.
(The format of our PDB-style files is described here.)

Timeline for d4wa8b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4wa8b1