Lineage for d4ufvc3 (4ufv C:211-410)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2574993Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2574994Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2575571Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2575572Protein automated matches [190038] (48 species)
    not a true protein
  7. 2575843Species Plasmodium vivax [TaxId:5855] [234134] (20 PDB entries)
  8. 2575903Domain d4ufvc3: 4ufv C:211-410 [344115]
    Other proteins in same PDB: d4ufva2, d4ufvb2, d4ufvc2
    complexed with 31a, cl, dms, goa, mg, nhw, so4

Details for d4ufvc3

PDB Entry: 4ufv (more details), 1.75 Å

PDB Description: plasmodium vivax n-myristoyltransferase in complex with a pyridyl inhibitor (compound 18)
PDB Compounds: (C:) Glycylpeptide N-tetradecanoyltransferase

SCOPe Domain Sequences for d4ufvc3:

Sequence, based on SEQRES records: (download)

>d4ufvc3 d.108.1.0 (C:211-410) automated matches {Plasmodium vivax [TaxId: 5855]}
yyhrsinvkklieigfsslnsrltmsraiklyrvedtlniknmrlmkkkdvegvhkllgs
yleqfnlyavftkeeiahwflpienviytyvneengkikdmisfyslpsqilgndkystl
naaysfynvtttatfkqlmqdaillakrnnfdvfnalevmqnksvfedlkfgegdgslky
ylynwkcasfapahvgivll

Sequence, based on observed residues (ATOM records): (download)

>d4ufvc3 d.108.1.0 (C:211-410) automated matches {Plasmodium vivax [TaxId: 5855]}
yyhrsinvkklieigfklyrvedtlniknmrlmkkkdvegvhkllgsyleqfnlyavftk
eeiahwflpienviytyvneengkikdmisfyslpsqilgndkystlnaaysfynvttta
tfkqlmqdaillakrnnfdvfnalevmqnksvfedlkfgegdgslkyylynwkcasfapa
hvgivll

SCOPe Domain Coordinates for d4ufvc3:

Click to download the PDB-style file with coordinates for d4ufvc3.
(The format of our PDB-style files is described here.)

Timeline for d4ufvc3: