Lineage for d4tsua_ (4tsu A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542783Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2543372Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2543464Family d.17.4.3: Ketosteroid isomerase-like [54434] (3 proteins)
    automatically mapped to Pfam PF12680
    automatically mapped to Pfam PF02136
  6. 2543677Protein automated matches [260878] (2 species)
    not a true protein
  7. 2543687Species Pseudomonas putida [TaxId:303] [260879] (3 PDB entries)
  8. 2543690Domain d4tsua_: 4tsu A: [344112]
    automated match to d3t8nb_
    complexed with equ

Details for d4tsua_

PDB Entry: 4tsu (more details), 2.5 Å

PDB Description: crystal structure of ketosteroid isomerase complexed with inhibitor
PDB Compounds: (A:) Ketosteroid Isomerase

SCOPe Domain Sequences for d4tsua_:

Sequence, based on SEQRES records: (download)

>d4tsua_ d.17.4.3 (A:) automated matches {Pseudomonas putida [TaxId: 303]}
nlptaqevqglmaryielvdvgdieaivqmyaddatvedpfgqppihgreqiaafyrqgl
gggkvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtmqayws
evnlsv

Sequence, based on observed residues (ATOM records): (download)

>d4tsua_ d.17.4.3 (A:) automated matches {Pseudomonas putida [TaxId: 303]}
nlptaqevqglmaryielvdvgdieaivqmyaddatvedpfgqppihgreqiaafyrqgl
kvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtmqaywsevn
lsv

SCOPe Domain Coordinates for d4tsua_:

Click to download the PDB-style file with coordinates for d4tsua_.
(The format of our PDB-style files is described here.)

Timeline for d4tsua_: