Lineage for d4rku1_ (4rku 1:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3028373Fold f.43: Chlorophyll a-b binding protein [103510] (1 superfamily)
    membrane all-alpha fold; three transmembrane helices
  4. 3028374Superfamily f.43.1: Chlorophyll a-b binding protein [103511] (2 families) (S)
    duplication: contains two structural repeats
  5. 3028425Family f.43.1.0: automated matches [276197] (1 protein)
    not a true family
  6. 3028426Protein automated matches [276200] (4 species)
    not a true protein
  7. 3028483Species Pea (Pisum sativum) [TaxId:3888] [276203] (10 PDB entries)
  8. 3028521Domain d4rku1_: 4rku 1: [344105]
    Other proteins in same PDB: d4rkua_, d4rkub_, d4rkuc_, d4rkud_, d4rkue_, d4rkuf_, d4rkuj_, d4rkul_
    automated match to d4y281_
    complexed with bcr, cl0, cla, dgd, g3p, lhg, lmg, lut, nex, pqn, sf4

Details for d4rku1_

PDB Entry: 4rku (more details), 3 Å

PDB Description: Crystal structure of plant Photosystem I at 3 Angstrom resolution
PDB Compounds: (1:) Chlorophyll a-b binding protein 6A, chloroplastic

SCOPe Domain Sequences for d4rku1_:

Sequence, based on SEQRES records: (download)

>d4rku1_ f.43.1.0 (1:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
prpsyldgsapgdfgfdplrlgevpenlerfkeselihcrwamlavpgilvpealglgnw
vkaqewaalpggqatylgnpvpwgtlptilvieflsiafvehqrsmekdpekkkypggaf
dplgyskdpkkfheykikevkngrlallafvgicvqqsaypgtgplenlathladpwhnn
ig

Sequence, based on observed residues (ATOM records): (download)

>d4rku1_ f.43.1.0 (1:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
prpsyldgsapgdfgfdplrlgevpenlerfkeselihcrwamlavpgilvpealglgnw
vkaqewaalvpwgtlptilvieflsiafvehqrsmekdpekkkypggafdplgyskdpkk
fheykikevkngrlallafvgicvqqsaypgtgplenlathladpwhnnig

SCOPe Domain Coordinates for d4rku1_:

Click to download the PDB-style file with coordinates for d4rku1_.
(The format of our PDB-style files is described here.)

Timeline for d4rku1_: