Lineage for d1qgnh_ (1qgn H:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2895682Family c.67.1.3: Cystathionine synthase-like [53402] (17 proteins)
  6. 2895767Protein Cystathionine gamma-synthase, CGS [53405] (2 species)
  7. 2895773Species Tobacco (Nicotiana tabacum) [TaxId:4097] [53407] (4 PDB entries)
  8. 2895817Domain d1qgnh_: 1qgn H: [34410]
    complexed with plp

Details for d1qgnh_

PDB Entry: 1qgn (more details), 2.9 Å

PDB Description: cystathionine gamma-synthase from nicotiana tabacum
PDB Compounds: (H:) protein (cystathionine gamma-synthase)

SCOPe Domain Sequences for d1qgnh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qgnh_ c.67.1.3 (H:) Cystathionine gamma-synthase, CGS {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
mkyasflnsdgsvaihagerlgrgivtdaittpvvntsayffnktselidfkekrrasfe
ygrygnpttvvleekisalegaestllmasgmcastvmllalvpagghivtttdcyrktr
ifietilpkmgitatvidpadvgalelalnqkkvnlfftesptnpflrcvdielvsklch
ekgalvcidgtfatplnqkalalgadlvlhsatkflgghndvlagcisgplklvseirnl
hhilggalnpnaayliirgmktlhlrvqqqnstalrmaeileahpkvrhvyypglqshpe
hhiakkqmtgfggavsfevdgdllttakfvdalkipyiapsfggcesivdqpaimsywdl
sqsdrakygimdnlvrfsfgvedfddlkadilqaldsi

SCOPe Domain Coordinates for d1qgnh_:

Click to download the PDB-style file with coordinates for d1qgnh_.
(The format of our PDB-style files is described here.)

Timeline for d1qgnh_: