Lineage for d4og5a2 (4og5 A:231-588)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2333768Superfamily a.118.8: TPR-like [48452] (10 families) (S)
  5. 2333769Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (21 protein domains)
  6. 2333808Protein Menin C-terminal domain [310725] (2 species)
  7. 2333809Species Human (Homo sapiens) [TaxId:9606] [310974] (27 PDB entries)
  8. 2333816Domain d4og5a2: 4og5 A:231-588 [344014]
    Other proteins in same PDB: d4og5a1
    complexed with 2s7, dms, peg, pg4, so4, tbf

Details for d4og5a2

PDB Entry: 4og5 (more details), 1.63 Å

PDB Description: Human menin with bound inhibitor MIV-5
PDB Compounds: (A:) Menin

SCOPe Domain Sequences for d4og5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4og5a2 a.118.8.1 (A:231-588) Menin C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
drkmevafmvcainpsidlhtdslellqlqqkllwllydlghlerypmalgnladleele
ptpgrpdpltlyhkgiasaktyyrdehiypymylagyhcrnrnvrealqawadtatviqd
ynycredeeiykeffevandvipnllkeaaslleagsqgsalqdpecfahllrfydgick
weegsptpvlhvgwatflvqslgrfegqvrqkvrivsvpapvltfqsekmkgmkellvat
kinssaiklqltaqsqvqmk

SCOPe Domain Coordinates for d4og5a2:

Click to download the PDB-style file with coordinates for d4og5a2.
(The format of our PDB-style files is described here.)

Timeline for d4og5a2:

  • d4og5a2 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d4og5a1