Lineage for d1cs1c_ (1cs1 C:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 26196Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
  4. 26197Superfamily c.67.1: PLP-dependent transferases [53383] (5 families) (S)
  5. 26361Family c.67.1.3: Cystathionine synthase-like [53402] (6 proteins)
  6. 26386Protein Cystathionine gamma-synthase [53405] (2 species)
  7. 26396Species Escherichia coli [TaxId:562] [53406] (1 PDB entry)
  8. 26399Domain d1cs1c_: 1cs1 C: [34401]

Details for d1cs1c_

PDB Entry: 1cs1 (more details), 1.5 Å

PDB Description: cystathionine gamma-synthase (cgs) from escherichia coli
PDB Compounds: (C:)

SCOP Domain Sequences for d1cs1c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cs1c_ c.67.1.3 (C:) Cystathionine gamma-synthase {Escherichia coli}
rkqatiavrsglnddeqygcvvppihlsstynftgfneprahdysrrgnptrdvvqrala
eleggagavltntgmsaihlvttvflkpgdllvaphdcyggsyrlfdslakrgcyrvlfv
dqgdeqalraalaekpklvlvespsnpllrvvdiakichlarevgavsvvdntflspalq
nplalgadlvlhsctkylnghsdvvagvviakdpdvvtelawwannigvtggafdsylll
rglrtlvprmelaqrnaqaivkylqtqplvkklyhpslpenqgheiaarqqkgfgamlsf
eldgdeqtlrrflgglslftlaeslggveslishaatmthagmapearaaagisetllri
stgiedgedliadlengfraankg

SCOP Domain Coordinates for d1cs1c_:

Click to download the PDB-style file with coordinates for d1cs1c_.
(The format of our PDB-style files is described here.)

Timeline for d1cs1c_: