SCOPe 2.05: Domain d1cl2b_: 1cl2 B:

Lineage for d1cl2b_ (1cl2 B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.3: Cystathionine synthase-like [53402] (17 proteins)

6. Protein Cystathionine beta-lyase, CBL [53403] (2 species)

7. Species Escherichia coli [TaxId:562] [53404] (6 PDB entries)

8. Domain d1cl2b_: 1cl2 B: [34398]
   complexed with ppg

Details for d1cl2b_

PDB Entry: 1cl2, 2.2 Å

PDB Description: cystathionine beta-lyase (cbl) from escherichia coli in complex with aminoethoxyvinylglycine

PDB Compounds: (B:) Cystathionine beta-lyase

SCOPe Domain Sequences for d1cl2b_:

Sequence; same for both SEQRES and ATOM records:

>d1cl2b_ c.67.1.3 (B:) Cystathionine beta-lyase, CBL {Escherichia coli [TaxId: 562]}
kkldtqlvnagrskkytlgavnsviqrasslvfdsveakkhatrnrangelfygrrgtlt
hfslqqamceleggagcvlfpcgaaavansilafieqgdhvlmtntayepsqdfcskils
klgvttswfdpligadivkhlqpntkivflespgsitmevhdvpaivaavrsvvpdaiim
idntwaagvlfkaldfgidvsiqaatkylvghsdamigtavcnarcweqlrenaylmgqm
vdadtayitsrglrtlgvrlrqhhesslkvaewlaehpqvarvnhpalpgskghefwkrd
ftgssglfsfvlkkklnneelanyldnfslfsmayswggyeslilanqpehiaairpqge
idfsgtlirlhigledvddliadldagfariv

Timeline for d1cl2b_:

• d1cl2b_ first appeared (with stable ids) in SCOP 1.55
  
• d1cl2b_ appears in SCOPe 2.04
  
• d1cl2b_ appears in SCOPe 2.06
  
• d1cl2b_ appears in the current release, SCOPe 2.08