Lineage for d1cl2a_ (1cl2 A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. Family c.67.1.3: Cystathionine synthase-like [53402] (17 proteins)
  6. Protein Cystathionine beta-lyase, CBL [53403] (2 species)
  7. Species Escherichia coli [TaxId:562] [53404] (6 PDB entries)
  8. Domain d1cl2a_: 1cl2 A: [34397]
    complexed with ppg

Details for d1cl2a_

PDB Entry: 1cl2 (more details), 2.2 Å

PDB Description: cystathionine beta-lyase (cbl) from escherichia coli in complex with aminoethoxyvinylglycine
PDB Compounds: (A:) Cystathionine beta-lyase

SCOPe Domain Sequences for d1cl2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cl2a_ c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Escherichia coli [TaxId: 562]}
kldtqlvnagrskkytlgavnsviqrasslvfdsveakkhatrnrangelfygrrgtlth
fslqqamceleggagcvlfpcgaaavansilafieqgdhvlmtntayepsqdfcskilsk
lgvttswfdpligadivkhlqpntkivflespgsitmevhdvpaivaavrsvvpdaiimi
dntwaagvlfkaldfgidvsiqaatkylvghsdamigtavcnarcweqlrenaylmgqmv
dadtayitsrglrtlgvrlrqhhesslkvaewlaehpqvarvnhpalpgskghefwkrdf
tgssglfsfvlkkklnneelanyldnfslfsmayswggyeslilanqpehiaairpqgei
dfsgtlirlhigledvddliadldagfariv

SCOPe Domain Coordinates for d1cl2a_ are not available.

Timeline for d1cl2a_:

Domains from other chains:
(mouse over for more information)
d1cl2b_