Lineage for d4ilhb2 (4ilh B:174-317)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2334634Superfamily a.118.29: U5 small nuclear riboprotein particle assembly factor Aar2 C-terminal domain-like [345916] (1 family) (S)
    C-terminal part of Pfam PF05282
    Structural similarity with VHS domains (48464) noted in PubMed 21764848, but no compelling evidence of homology
  5. 2334635Family a.118.29.1: U5 small nuclear riboprotein particle assembly factor Aar2 C-terminal domain-like [345957] (2 protein domains)
  6. 2334636Protein U5 small nuclear riboprotein particle assembly factor Aar2 C-terminal domain [346042] (1 species)
  7. 2334637Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [346205] (5 PDB entries)
  8. 2334639Domain d4ilhb2: 4ilh B:174-317 [343967]
    Other proteins in same PDB: d4ilha1, d4ilha2, d4ilhb1
    automated match to d3sbsa2
    mutant

Details for d4ilhb2

PDB Entry: 4ilh (more details), 1.85 Å

PDB Description: Crystal structure of an Aar2p C-terminal deletion mutant in conplex with Prp8p RNaseH
PDB Compounds: (B:) A1 cistron-splicing factor AAR2

SCOPe Domain Sequences for d4ilhb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ilhb2 a.118.29.1 (B:174-317) U5 small nuclear riboprotein particle assembly factor Aar2 C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
hslnytvinfksreairpghemedfldksyylntvmlqgifknssnyfgelqfaflnamf
fgnygsslqwhamielicssatvpkhmldkldeilyyqiktlpeqysdillnervwnicl
yssfqknslhntekimenkypell

SCOPe Domain Coordinates for d4ilhb2:

Click to download the PDB-style file with coordinates for d4ilhb2.
(The format of our PDB-style files is described here.)

Timeline for d4ilhb2:

  • d4ilhb2 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d4ilhb1