Lineage for d1cl1b_ (1cl1 B:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 73100Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
  4. 73101Superfamily c.67.1: PLP-dependent transferases [53383] (5 families) (S)
  5. 73298Family c.67.1.3: Cystathionine synthase-like [53402] (7 proteins)
  6. 73317Protein Cystathionine beta-lyase, CBL [53403] (2 species)
  7. 73318Species Escherichia coli [TaxId:562] [53404] (2 PDB entries)
  8. 73320Domain d1cl1b_: 1cl1 B: [34396]

Details for d1cl1b_

PDB Entry: 1cl1 (more details), 1.83 Å

PDB Description: cystathionine beta-lyase (cbl) from escherichia coli
PDB Compounds: (B:)

SCOP Domain Sequences for d1cl1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cl1b_ c.67.1.3 (B:) Cystathionine beta-lyase, CBL {Escherichia coli}
kkldtqlvnagrskkytlgavnsviqrasslvfdsveakkhatrnrangelfygrrgtlt
hfslqqamceleggagcvlfpcgaaavansilafieqgdhvlmtntayepsqdfcskils
klgvttswfdpligadivkhlqpntkivflespgsitmevhdvpaivaavrsvvpdaiim
idntwaagvlfkaldfgidvsiqaatkylvghsdamigtavcnarcweqlrenaylmgqm
vdadtayitsrglrtlgvrlrqhhesslkvaewlaehpqvarvnhpalpgskghefwkrd
ftgssglfsfvlkkklnneelanyldnfslfsmayswggyeslilanqpehiaairpqge
idfsgtlirlhigledvddliadldagfariv

SCOP Domain Coordinates for d1cl1b_:

Click to download the PDB-style file with coordinates for d1cl1b_.
(The format of our PDB-style files is described here.)

Timeline for d1cl1b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1cl1a_