![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
![]() | Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) ![]() |
![]() | Family c.67.1.3: Cystathionine synthase-like [53402] (17 proteins) |
![]() | Protein Cystathionine beta-lyase, CBL [53403] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [53404] (6 PDB entries) |
![]() | Domain d1cl1b_: 1cl1 B: [34396] complexed with bct |
PDB Entry: 1cl1 (more details), 1.83 Å
SCOPe Domain Sequences for d1cl1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cl1b_ c.67.1.3 (B:) Cystathionine beta-lyase, CBL {Escherichia coli [TaxId: 562]} kkldtqlvnagrskkytlgavnsviqrasslvfdsveakkhatrnrangelfygrrgtlt hfslqqamceleggagcvlfpcgaaavansilafieqgdhvlmtntayepsqdfcskils klgvttswfdpligadivkhlqpntkivflespgsitmevhdvpaivaavrsvvpdaiim idntwaagvlfkaldfgidvsiqaatkylvghsdamigtavcnarcweqlrenaylmgqm vdadtayitsrglrtlgvrlrqhhesslkvaewlaehpqvarvnhpalpgskghefwkrd ftgssglfsfvlkkklnneelanyldnfslfsmayswggyeslilanqpehiaairpqge idfsgtlirlhigledvddliadldagfariv
Timeline for d1cl1b_: