Lineage for d1cl1a_ (1cl1 A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 26196Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
  4. 26197Superfamily c.67.1: PLP-dependent transferases [53383] (5 families) (S)
  5. 26361Family c.67.1.3: Cystathionine synthase-like [53402] (6 proteins)
  6. 26380Protein Cystathionine beta-lyase, CBL [53403] (1 species)
  7. 26381Species Escherichia coli [TaxId:562] [53404] (2 PDB entries)
  8. 26382Domain d1cl1a_: 1cl1 A: [34395]

Details for d1cl1a_

PDB Entry: 1cl1 (more details), 1.83 Å

PDB Description: cystathionine beta-lyase (cbl) from escherichia coli
PDB Compounds: (A:)

SCOP Domain Sequences for d1cl1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cl1a_ c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Escherichia coli}
kldtqlvnagrskkytlgavnsviqrasslvfdsveakkhatrnrangelfygrrgtlth
fslqqamceleggagcvlfpcgaaavansilafieqgdhvlmtntayepsqdfcskilsk
lgvttswfdpligadivkhlqpntkivflespgsitmevhdvpaivaavrsvvpdaiimi
dntwaagvlfkaldfgidvsiqaatkylvghsdamigtavcnarcweqlrenaylmgqmv
dadtayitsrglrtlgvrlrqhhesslkvaewlaehpqvarvnhpalpgskghefwkrdf
tgssglfsfvlkkklnneelanyldnfslfsmayswggyeslilanqpehiaairpqgei
dfsgtlirlhigledvddliadldagfariv

SCOP Domain Coordinates for d1cl1a_:

Click to download the PDB-style file with coordinates for d1cl1a_.
(The format of our PDB-style files is described here.)

Timeline for d1cl1a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1cl1b_