![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.65: triple barrel [50915] (1 superfamily) dimer of two non-identical subunits; forms two similar barrels, n=8, S=10 each, that are fused together with the formation of third barrel, n=6, S=8 |
![]() | Superfamily b.65.1: Rap30/74 interaction domain-like [50916] (3 families) ![]() |
![]() | Family b.65.1.2: RNA polymerase I A49/34.5, interaction domains [345965] (3 proteins) Homology with TFIIF discussed in PubMed 20797630 |
![]() | Protein automated matches [346059] (1 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [346254] (1 PDB entry) |
![]() | Domain d4c3in_: 4c3i N: [343941] Other proteins in same PDB: d4c3ia_, d4c3ib_, d4c3ie1, d4c3ie2, d4c3if_, d4c3ig1, d4c3ih_, d4c3ii1, d4c3ii2, d4c3ij_, d4c3ik_, d4c3il_, d4c3im_ automated match to d4c3hn_ complexed with mg, mpd, so4, zn |
PDB Entry: 4c3i (more details), 3 Å
SCOPe Domain Sequences for d4c3in_:
Sequence, based on SEQRES records: (download)
>d4c3in_ b.65.1.2 (N:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} fsipdgfkkckhlknfplngdnkkkakqqqvwlikfpsnvdisklkslpvdfessttmti dkhdykimddtdiessltqdnlsnmtllvpseskeslkiastakdnaplqfdkvfsvset akipaidyskvrvprkdvpkveglklehfatgydaedf
>d4c3in_ b.65.1.2 (N:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} fsipdgfkkckhlknfplngdnkqqqvwlikfpsnvdisklkslpvdfessttmtidkhd ykimddtdnmtllvpseskeslkiastaplqfdkvfsvsetakipaidyskvrvprkdvp kveglklehfatgydaedf
Timeline for d4c3in_: