Lineage for d4c3in_ (4c3i N:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2397876Fold b.65: triple barrel [50915] (1 superfamily)
    dimer of two non-identical subunits; forms two similar barrels, n=8, S=10 each, that are fused together with the formation of third barrel, n=6, S=8
  4. 2397877Superfamily b.65.1: Rap30/74 interaction domain-like [50916] (3 families) (S)
  5. 2397891Family b.65.1.2: RNA polymerase I A49/34.5, interaction domains [345965] (3 proteins)
    Homology with TFIIF discussed in PubMed 20797630
  6. 2397928Protein automated matches [346059] (1 species)
    not a true protein
  7. 2397929Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [346254] (1 PDB entry)
  8. 2397930Domain d4c3in_: 4c3i N: [343941]
    Other proteins in same PDB: d4c3ia_, d4c3ib_, d4c3ie1, d4c3ie2, d4c3if_, d4c3ig1, d4c3ih_, d4c3ii1, d4c3ii2, d4c3ij_, d4c3ik_, d4c3il_, d4c3im_
    automated match to d4c3hn_
    complexed with mg, mpd, so4, zn

Details for d4c3in_

PDB Entry: 4c3i (more details), 3 Å

PDB Description: structure of 14-subunit rna polymerase i at 3.0 a resolution, crystal form c2-100
PDB Compounds: (N:) DNA-directed RNA polymerase I subunit RPA34

SCOPe Domain Sequences for d4c3in_:

Sequence, based on SEQRES records: (download)

>d4c3in_ b.65.1.2 (N:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
fsipdgfkkckhlknfplngdnkkkakqqqvwlikfpsnvdisklkslpvdfessttmti
dkhdykimddtdiessltqdnlsnmtllvpseskeslkiastakdnaplqfdkvfsvset
akipaidyskvrvprkdvpkveglklehfatgydaedf

Sequence, based on observed residues (ATOM records): (download)

>d4c3in_ b.65.1.2 (N:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
fsipdgfkkckhlknfplngdnkqqqvwlikfpsnvdisklkslpvdfessttmtidkhd
ykimddtdnmtllvpseskeslkiastaplqfdkvfsvsetakipaidyskvrvprkdvp
kveglklehfatgydaedf

SCOPe Domain Coordinates for d4c3in_:

Click to download the PDB-style file with coordinates for d4c3in_.
(The format of our PDB-style files is described here.)

Timeline for d4c3in_:

  • d4c3in_ is new in SCOPe 2.07-stable