Lineage for d4c3ii2 (4c3i I:65-125)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2587435Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2587508Superfamily g.41.3: Zinc beta-ribbon [57783] (5 families) (S)
  5. 2587509Family g.41.3.1: Transcriptional factor domain [57784] (6 proteins)
  6. 2587588Protein automated matches [254700] (2 species)
    not a true protein
  7. 2587589Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255950] (4 PDB entries)
  8. 2587593Domain d4c3ii2: 4c3i I:65-125 [343939]
    Other proteins in same PDB: d4c3ia_, d4c3ib_, d4c3ie1, d4c3ie2, d4c3if_, d4c3ig1, d4c3ih_, d4c3ij_, d4c3ik_, d4c3il_, d4c3im_, d4c3in_
    automated match to d4c3hi2
    complexed with mg, mpd, so4, zn

Details for d4c3ii2

PDB Entry: 4c3i (more details), 3 Å

PDB Description: structure of 14-subunit rna polymerase i at 3.0 a resolution, crystal form c2-100
PDB Compounds: (I:) DNA-directed RNA polymerase I subunit rpa12

SCOPe Domain Sequences for d4c3ii2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c3ii2 g.41.3.1 (I:65-125) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
svvktslkknelkdgatikekcpqcgneemnyhtlqlrsadegatvfytctscgykfrtn
n

SCOPe Domain Coordinates for d4c3ii2:

Click to download the PDB-style file with coordinates for d4c3ii2.
(The format of our PDB-style files is described here.)

Timeline for d4c3ii2:

  • d4c3ii2 is new in SCOPe 2.07-stable