Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.230: Dodecin subunit-like [88797] (9 superfamilies) beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132 |
Superfamily d.230.1: N-terminal, heterodimerisation domain of RBP7 (RpoE) [88798] (3 families) automatically mapped to Pfam PF03876 |
Family d.230.1.0: automated matches [345977] (1 protein) not a true family |
Protein automated matches [346111] (1 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [346397] (1 PDB entry) |
Domain d4c3ig1: 4c3i G:8-126 [343937] Other proteins in same PDB: d4c3ia_, d4c3ib_, d4c3ie1, d4c3ie2, d4c3if_, d4c3ih_, d4c3ii1, d4c3ii2, d4c3ij_, d4c3ik_, d4c3il_, d4c3im_, d4c3in_ automated match to d4c3hg1 complexed with mg, mpd, so4, zn |
PDB Entry: 4c3i (more details), 3 Å
SCOPe Domain Sequences for d4c3ig1:
Sequence, based on SEQRES records: (download)
>d4c3ig1 d.230.1.0 (G:8-126) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} nenretarfikkhkkqvtnpidekngtsncivrvpialyvslapmylenplqgvmkqhln plvmkynnkvggvvlgyeglkildadplskedtseklikitpdtpfgftwchvnlyvwq
>d4c3ig1 d.230.1.0 (G:8-126) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} nenretarfikkhkkqvtnpidekngtsncivrvpialyvslapmylenplqgvmkqhln plvmkynnkvggvvlgyeglkildadpldtseklikitpdtpfgftwchvnlyvwq
Timeline for d4c3ig1: