Lineage for d4c3ig1 (4c3i G:8-126)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3007999Fold d.230: Dodecin subunit-like [88797] (9 superfamilies)
    beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132
  4. 3008000Superfamily d.230.1: N-terminal, heterodimerisation domain of RBP7 (RpoE) [88798] (3 families) (S)
    automatically mapped to Pfam PF03876
  5. 3008031Family d.230.1.0: automated matches [345977] (1 protein)
    not a true family
  6. 3008032Protein automated matches [346111] (1 species)
    not a true protein
  7. 3008033Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [346397] (1 PDB entry)
  8. 3008034Domain d4c3ig1: 4c3i G:8-126 [343937]
    Other proteins in same PDB: d4c3ia_, d4c3ib_, d4c3ie1, d4c3ie2, d4c3if_, d4c3ih_, d4c3ii1, d4c3ii2, d4c3ij_, d4c3ik_, d4c3il_, d4c3im_, d4c3in_
    automated match to d4c3hg1
    complexed with mg, mpd, so4, zn

Details for d4c3ig1

PDB Entry: 4c3i (more details), 3 Å

PDB Description: structure of 14-subunit rna polymerase i at 3.0 a resolution, crystal form c2-100
PDB Compounds: (G:) DNA-directed RNA polymerase I subunit rpa43

SCOPe Domain Sequences for d4c3ig1:

Sequence, based on SEQRES records: (download)

>d4c3ig1 d.230.1.0 (G:8-126) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nenretarfikkhkkqvtnpidekngtsncivrvpialyvslapmylenplqgvmkqhln
plvmkynnkvggvvlgyeglkildadplskedtseklikitpdtpfgftwchvnlyvwq

Sequence, based on observed residues (ATOM records): (download)

>d4c3ig1 d.230.1.0 (G:8-126) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nenretarfikkhkkqvtnpidekngtsncivrvpialyvslapmylenplqgvmkqhln
plvmkynnkvggvvlgyeglkildadpldtseklikitpdtpfgftwchvnlyvwq

SCOPe Domain Coordinates for d4c3ig1:

Click to download the PDB-style file with coordinates for d4c3ig1.
(The format of our PDB-style files is described here.)

Timeline for d4c3ig1: