Lineage for d4c3ia_ (4c3i A:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2574250Fold e.29: beta and beta-prime subunits of DNA dependent RNA-polymerase [64483] (1 superfamily)
    Multidomain subunits of complex domain organization
  4. 2574251Superfamily e.29.1: beta and beta-prime subunits of DNA dependent RNA-polymerase [64484] (2 families) (S)
    The catalytic site is formed by the association of two double-psi beta-barrel domains, one from each subunit
  5. 2574346Family e.29.1.2: RNA-polymerase beta-prime [64490] (4 proteins)
  6. 2574414Protein automated matches [254473] (5 species)
    not a true protein
  7. 2574415Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255953] (4 PDB entries)
  8. 2574417Domain d4c3ia_: 4c3i A: [343935]
    Other proteins in same PDB: d4c3ib_, d4c3ie1, d4c3ie2, d4c3if_, d4c3ig1, d4c3ih_, d4c3ii1, d4c3ii2, d4c3ij_, d4c3ik_, d4c3il_, d4c3im_, d4c3in_
    automated match to d4c3ha_
    complexed with mg, mpd, so4, zn

Details for d4c3ia_

PDB Entry: 4c3i (more details), 3 Å

PDB Description: structure of 14-subunit rna polymerase i at 3.0 a resolution, crystal form c2-100
PDB Compounds: (A:) DNA-directed RNA polymerase I subunit rpa190

SCOPe Domain Sequences for d4c3ia_:

Sequence, based on SEQRES records: (download)

>d4c3ia_ e.29.1.2 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mdiskpvgseitsvdfgiltakeirnlsakqitnptvldnlghpvsgglydlalgaflrn
lcstcgldekfcpghqghielpvpcynplffnqlyiylrasclfchhfrlksvevhryac
klrllqyglidesykldeitlgslnssmytddeaiednedemdgegskqskdisstllne
lkskrseyvdmaiakalsdgrttergsftatvnderkklvhefhkkllsrgkcdncgmfs
pkfrkdgftkifetalnekqitnnrvkgfirqdmikkqkqakkldgsneasandeesfdv
grnpttrpktgstyilstevknildtvfrkeqcvlqyvfhsrpnlsrklvkadsffmdvl
vvpptrfrlpsklgeevhensqnqllskvlttsllirdlnddlsklqkdkvsledrrvif
srlmnafvtiqndvnafidstkaqgrtsgkvpipgvkqalekkeglfrkhmmgkrvnyaa
rsvispdpnietneigvppvfavkltypepvtayniaelrqavingpdkwpgatqiqned
gslvsligmsveqrkalanqlltpssnvsthtlnkkvyrhiknrdvvlmnrqptlhkasm
mghkvrvlpnektlrlhyantgaynadfdgdemnmhfpqnenaraealnlantdsqyltp
tsgspvrgliqdhisagvwltskdsfftreqyqqyiygcirpedghttrskivtlpptif
kpyplwtgkqiittvllnvtppdmpginlisknkikneywgkgslenevlfkdgallcgi
ldksqygaskygivhslhevygpevaakvlsvlgrlftnyitataftcgmddlrltaegn
kwrtdilktsvdtgreaaaevtnldkdtpaddpellkrlqeilrdnnksgildavtsskv
naitsqvvskcvpdgtmkkfpcnsmqamalsgakgsnvnvsqimcllgqqalegrrvpvm
vsgktlpsfkpyetdamaggyvkgrfysgikpqeyyfhcmagreglidtavktsrsgylq
rcltkqlegvhvsydnsirdadgtlvqfmyggdaiditkeshmtqfefcldnyyallkky
npsaliehldvesalkyskktlkyrkkhskephykqsvkydpvlakynpakylgsvsenf
qdklesfldknsklfkssdgvnekkfralmqlkymrslinpgeavgiiasqsvgepstqm
tlntfhfaghgaanvtlgiprlreivmtasaaiktpqmtlpiwndvsdeqadtfcksisk
vllsevidkvivtettgtsntaggnaarsyvihmrffdnneyseeydvskeelqnvisnq
fihlleaaivkeikkqkrttgpdigvavprlqtdvansssnskrleedndeeqshkktkq
avsydepdedeietmreaekssdeegidsdkesdsdsededvdmneqinksiveannnmn
kvqrdrqsaiishhrfitkynfddesgkwcefklelaadtekllmvniveeicrksiirq
iphidrcvhpepengkrvlvtegvnfqamwdqeafidvdgitsndvaavlktygveaarn
tivneinnvfsryaisvsfrhldliadmmtrqgtylafnrqgmetstssfmkmsyettcq
fltkavldnereqldspsarivvgklnnvgtgsfdvlakvpna

Sequence, based on observed residues (ATOM records): (download)

>d4c3ia_ e.29.1.2 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mdiskpvgseitsvdfgiltakeirnlsakqitnptvldnlghpvsgglydlalgaflrn
lcstcgldekfcpghqghielpvpcynplffnqlyiylrasclfchhfrlksvevhryac
klrllqyglidesykldeitldisstllnelkskrseyvdmaiakalsdgrttergsfta
tvnderkklvhefhkkllsrgkcdncgmfspkfrkdgftkifetalnekqitnnrvkgfi
rqdmistyilstevknildtvfrkeqcvlqyvfhsrpnlsrklvkadsffmdvlvvpptr
frlpsklgeevhensqnqllskvlttsllirdlnddlsklkvsledrrvifsrlmnafvt
iqndvnafidstkaqgrtvpipgvkqalekkeglfrkhmmgkrvnyaarsvispdpniet
neigvppvfavkltypepvtayniaelrqavingpdkwpgatqiqnedgslvsligmsve
qrkalanqlltpssnvsthtlnkkvyrhiknrdvvlmnrqptlhkasmmghkvrvlpnek
tlrlhyantgaynadfdgdemnmhfpqnenaraealnlantdsqyltptsgspvrgliqd
hisagvwltskdsfftreqyqqyiygcirpedghttrskivtlpptifkpyplwtgkqii
ttvllnvtppdmpginlisknkikneywgkgslenevlfkdgallcgildksqygaskyg
ivhslhevygpevaakvlsvlgrlftnyitataftcgmddlrltaegnkwrtdilktsvd
tgreaaaevtnldkdtpaddpellkrlqeilrdnnksgildavtsskvnaitsqvvskcv
pdgtmkkfpcnsmqamalsgakgsnvnvsqimcllgqqalegrrvpvmvsgktlpsfkpy
etdamaggyvkgrfysgikpqeyyfhcmagreglidtavktsrsgylqrcltkqlegvhv
sydnsirdadgtlvqfmyggdaiditkeshmtqfefcldnyyallkkynpsaliehldve
salkyskktlkyrkkhskephykqsvkydpvlakynpakylgsvsenfqdklesfldkns
kgvnekkfralmqlkymrslinpgeavgiiasqsvgepstqmtlntfnvtlgiprlreiv
mtasaaiktpqmtlpiwndvsdeqadtfcksiskvllsevidkvivtettgtarsyvihm
rffdnneyseeydvskeelqnvisnqfihlleaaivkeikkqkrttgpdigvavprlqnm
nkvqrdrqsaiishhrfitkynfddesgkwcefklelaadtekllmvniveeicrksiir
qiphidrcvhpepengkrvlvtegvnfqamwdqeafidvdgitsndvaavlktygveaar
ntivneinnvfsryaisvsfrhldliadmmtrqgtylafnrqgmetstssfmkmsyettc
qfltkavldnereqldspsarivvgklnnvgtgsfdvlakvpna

SCOPe Domain Coordinates for d4c3ia_:

Click to download the PDB-style file with coordinates for d4c3ia_.
(The format of our PDB-style files is described here.)

Timeline for d4c3ia_:

  • d4c3ia_ is new in SCOPe 2.07-stable