Lineage for d1ax4b_ (1ax4 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2131389Family c.67.1.2: Beta-eliminating lyases [53397] (3 protein domains)
  6. 2131390Protein Tryptophan indol-lyase (tryptophanase) [53400] (2 species)
  7. 2131403Species Proteus vulgaris [TaxId:585] [53401] (1 PDB entry)
  8. 2131405Domain d1ax4b_: 1ax4 B: [34392]
    complexed with k

Details for d1ax4b_

PDB Entry: 1ax4 (more details), 2.1 Å

PDB Description: tryptophanase from proteus vulgaris
PDB Compounds: (B:) tryptophanase

SCOPe Domain Sequences for d1ax4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ax4b_ c.67.1.2 (B:) Tryptophan indol-lyase (tryptophanase) {Proteus vulgaris [TaxId: 585]}
akrivepfrikmvekirvpsreereaalkeagynpfllpssavyidlltdsgtnamsdhq
waamitgdeayagsrnyydlkdkakelfnydyiipahqgrgaenilfpvllkykqkegka
knpvfisnfhfdttaahvelngckainivtekafdsetyddwkgdfdikklkeniaqhga
dnivaivstvtcnsaggqpvsmsnlkevyeiakqhgifvvmdsarfcenayfikardpky
knatikevifdmykyadaltmsakkdpllnigglvairdneeiftlarqrcvpmegfvty
gglagrdmaamvqgleegteeeylhyrigqvkylgdrlreagipiqyptgghavfvdckk
lvpqipgdqfpaqavinalylesgvraveigsfllgrdpatgeqkhadmefmrltiarrv
ytndhmdyiadaliglkekfatlkglefeyeppvlrhftarlkpi

SCOPe Domain Coordinates for d1ax4b_:

Click to download the PDB-style file with coordinates for d1ax4b_.
(The format of our PDB-style files is described here.)

Timeline for d1ax4b_: