Lineage for d1ax4a_ (1ax4 A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 26196Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
  4. 26197Superfamily c.67.1: PLP-dependent transferases [53383] (5 families) (S)
  5. 26348Family c.67.1.2: Beta-eliminating lyases [53397] (2 proteins)
  6. 26349Protein Tryptophan indol-lyase (tryptophanase) [53400] (1 species)
  7. 26350Species Proteus vulgaris [TaxId:585] [53401] (1 PDB entry)
  8. 26351Domain d1ax4a_: 1ax4 A: [34391]

Details for d1ax4a_

PDB Entry: 1ax4 (more details), 2.1 Å

PDB Description: tryptophanase from proteus vulgaris

SCOP Domain Sequences for d1ax4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ax4a_ c.67.1.2 (A:) Tryptophan indol-lyase (tryptophanase) {Proteus vulgaris}
akrivepfrikmvekirvpsreereaalkeagynpfllpssavyidlltdsgtnamsdhq
waamitgdeayagsrnyydlkdkakelfnydyiipahqgrgaenilfpvllkykqkegka
knpvfisnfhfdttaahvelngckainivtekafdsetyddwkgdfdikklkeniaqhga
dnivaivstvtcnsaggqpvsmsnlkevyeiakqhgifvvmdsarfcenayfikardpky
knatikevifdmykyadaltmsakkdpllnigglvairdneeiftlarqrcvpmegfvty
gglagrdmaamvqgleegteeeylhyrigqvkylgdrlreagipiqyptgghavfvdckk
lvpqipgdqfpaqavinalylesgvraveigsfllgrdpatgeqkhadmefmrltiarrv
ytndhmdyiadaliglkekfatlkglefeyeppvlrhftarlkpi

SCOP Domain Coordinates for d1ax4a_:

Click to download the PDB-style file with coordinates for d1ax4a_.
(The format of our PDB-style files is described here.)

Timeline for d1ax4a_: