SCOPe 2.08: Domain d3wmou_: 3wmo U:

Lineage for d3wmou_ (3wmo U:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.3: Light-harvesting complex subunits [56917] (1 superfamily)
   membrane all-alpha fold

4. Superfamily f.3.1: Light-harvesting complex subunits [56918] (2 families)

5. Family f.3.1.0: automated matches [254203] (1 protein)
   not a true family

6. Protein automated matches [254444] (10 species)
   not a true protein

7. Species Thermochromatium tepidum [TaxId:1050] [267909] (5 PDB entries)

8. Domain d3wmou_: 3wmo U: [343905]
   Other proteins in same PDB: d3wmoc_, d3wmoh1, d3wmoh2, d3wmom_
   automated match to d3wmm1_
   complexed with bcl, bph, ca, crt, fe, hem, mq8, pef, po4, uq8

Details for d3wmou_

PDB Entry: 3wmo, 3.01 Å

PDB Description: Crystal structure of the LH1-RC complex from Thermochromatium tepidum in P21 form

PDB Compounds: (U:) LH1 alpha polypeptide

SCOPe Domain Sequences for d3wmou_:

Sequence; same for both SEQRES and ATOM records:

>d3wmou_ f.3.1.0 (U:) automated matches {Thermochromatium tepidum [TaxId: 1050]}
ftmnanlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalg

Timeline for d3wmou_:

• d3wmou_ first appeared in SCOPe 2.07