Lineage for d2tplb_ (2tpl B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2131389Family c.67.1.2: Beta-eliminating lyases [53397] (3 protein domains)
  6. 2131408Protein Tyrosine phenol-lyase [53398] (2 species)
  7. 2131409Species Citrobacter intermedius [TaxId:66695] [53399] (2 PDB entries)
  8. 2131413Domain d2tplb_: 2tpl B: [34390]
    complexed with cs, hpp

Details for d2tplb_

PDB Entry: 2tpl (more details), 2.5 Å

PDB Description: tyrosine phenol-lyase from citrobacter intermedius complex with 3-(4'-hydroxyphenyl)propionic acid, pyridoxal-5'-phosphate and cs+ ion
PDB Compounds: (B:) tyrosine phenol-lyase

SCOPe Domain Sequences for d2tplb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2tplb_ c.67.1.2 (B:) Tyrosine phenol-lyase {Citrobacter intermedius [TaxId: 66695]}
nypaepfriksvetvsmiprderlkkmqeagyntfllnskdiyidlltdsgtnamsdkqw
agmmmgdeayagsenfyhlertvqelfgfkhivpthqgrgaenllsqlaikpgqyvagnm
yftttryhqekngavfvdivrdeahdaglniafkgdidlkklqklidekgaeniayicla
vtvnlaggqpvsmanmravreltaahgikvfydatrcvenayfikeqeqgfenksiaeiv
hemfsyadgctmsgkkdclvniggflcmnddemfssakelvvvyegmpsygglagrdmea
maiglreamqyeyiehrvkqvrylgdklkaagvpivepvgghavfldarrfcehltqdef
paqslaasiyvetgvrsmergiisagrnnvtgehhrpkletvrltiprrvytyahmdvva
dgiiklyqhkedirglkfiyepkqlrfftarfdyi

SCOPe Domain Coordinates for d2tplb_:

Click to download the PDB-style file with coordinates for d2tplb_.
(The format of our PDB-style files is described here.)

Timeline for d2tplb_: