SCOPe 2.07: Domain d3wmnf_: 3wmn F:

Lineage for d3wmnf_ (3wmn F:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.3: Light-harvesting complex subunits [56917] (1 superfamily)
   membrane all-alpha fold

4. Superfamily f.3.1: Light-harvesting complex subunits [56918] (2 families)

5. Family f.3.1.0: automated matches [254203] (1 protein)
   not a true family

6. Protein automated matches [254444] (7 species)
   not a true protein

7. Species Thermochromatium tepidum [TaxId:1050] [267909] (5 PDB entries)

8. Domain d3wmnf_: 3wmn F: [343891]
   Other proteins in same PDB: d3wmnc_, d3wmnh1, d3wmnh2, d3wmnm_
   automated match to d3wmm1_
   complexed with bcl, bph, ca, crt, fe, hem, mq8, pef, po4, uq8

Details for d3wmnf_

PDB Entry: 3wmn, 3.01 Å

PDB Description: Crystal structure of the LH1-RC complex from Thermochromatium tepidum in P21 form

PDB Compounds: (F:) LH1 alpha polypeptide

SCOPe Domain Sequences for d3wmnf_:

Sequence; same for both SEQRES and ATOM records:

>d3wmnf_ f.3.1.0 (F:) automated matches {Thermochromatium tepidum [TaxId: 1050]}
tmnanlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalgkk

Timeline for d3wmnf_:

• d3wmnf_ is new in SCOPe 2.07-stable
  
• d3wmnf_ appears in the current release, SCOPe 2.08