Lineage for d3vrqb3 (3vrq B:12-147)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2327716Fold a.48: N-cbl like [47667] (5 superfamilies)
    4 helices; bundle, left-handed twist; left-handed superhelix
  4. 2327717Superfamily a.48.1: N-terminal domain of cbl (N-cbl) [47668] (2 families) (S)
    automatically mapped to Pfam PF02262
  5. 2327718Family a.48.1.1: N-terminal domain of cbl (N-cbl) [47669] (1 protein)
  6. 2327719Protein N-terminal domain of cbl (N-cbl) [47670] (1 species)
  7. 2327720Species Human (Homo sapiens) [TaxId:9606] [47671] (13 PDB entries)
  8. 2327731Domain d3vrqb3: 3vrq B:12-147 [343884]
    Other proteins in same PDB: d3vrqa1, d3vrqa2, d3vrqb1, d3vrqb2
    complexed with ca; mutant

Details for d3vrqb3

PDB Entry: 3vrq (more details), 2.39 Å

PDB Description: Crystal structure of the tyrosine kinase binding domain of Cbl-c (PL mutant)
PDB Compounds: (B:) Signal transduction protein CBL-C

SCOPe Domain Sequences for d3vrqb3:

Sequence, based on SEQRES records: (download)

>d3vrqb3 a.48.1.1 (B:12-147) N-terminal domain of cbl (N-cbl) {Human (Homo sapiens) [TaxId: 9606]}
weearalgravrmlqrleeqcvdprlsvsppslrdllprtaqllrevahsrraaggggpg
gpggsgdflliylanleaksrqvaallpprgrrsandelfragsrlrrqlaklaiifshm
haelhalfpggkycgh

Sequence, based on observed residues (ATOM records): (download)

>d3vrqb3 a.48.1.1 (B:12-147) N-terminal domain of cbl (N-cbl) {Human (Homo sapiens) [TaxId: 9606]}
weearalgravrmlqrleeqcvsppslrdllprtaqllrevahsrrapggpggsgdflli
ylanleaksrqvaalrlrrqlaklaiifshmhaelhalfpggkycgh

SCOPe Domain Coordinates for d3vrqb3:

Click to download the PDB-style file with coordinates for d3vrqb3.
(The format of our PDB-style files is described here.)

Timeline for d3vrqb3: